Description

  • Product name

    Recombinant human I-FABP protein
    See all I-FABP proteins and peptides
  • Biological activity

    The binding affinity of ab179974 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration.

    Half-maximal fluorescence of 3 µM ab179974 is achieved with approximately 3 µM cis-paranaric acid.

  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVK ESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN ELNTVREIIGDELVQTYVYEGVEAKRIFKKD
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      2 to 132
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000125

Specifications

Our Abpromise guarantee covers the use of ab179974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as intestinal FABP.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilised product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • FABP 2
    • FABP2
    • FABPI
    • FABPI_HUMAN
    • Fatty acid binding protein
    • Fatty acid binding protein 2 intestinal
    • Fatty acid binding protein intestinal
    • Fatty acid-binding protein
    • Fatty acid-binding protein 2
    • I FABP
    • I-FABP
    • IFABP
    • intestinal
    • intestinal FABP
    • Intestinal fatty acid binding protein 2
    • Intestinal-type fatty acid-binding protein
    • MGC133132
    • OTTHUMP00000163925
    see all
  • Function

    FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
  • Tissue specificity

    Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • Human FABP2 (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 98%.
  • DTT-reduced SDS-PAGE analysis of ab179974 stained overnight with Coomassie Blue.

References

ab179974 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up