Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGF KEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGET FSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 147
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Supplied as a 0.2 µm Ø filtered solution.

General Info

  • Alternative names
    • AIF 1
    • AIF-1
    • Aif1
    • AIF1 protein
    • AIF1_HUMAN
    • Allograft inflammatory factor 1
    • Allograft inflammatory factor 1 splice variant G
    • allograft inflammatory factor-1 splice variant Hara-1
    • balloon angioplasty responsive transcription
    • BART 1
    • G1
    • G1 putative splice variant of allograft inflamatory factor 1
    • IBA 1
    • IBA1
    • interferon gamma responsive transcript
    • Interferon responsive transcript 1
    • interferon responsive transcript factor 1
    • Ionized calcium binding adapter molecule 1
    • ionized calcium-binding adapter molecule
    • Ionized calcium-binding adapter molecule 1
    • IRT 1
    • IRT1
    • Microglia response factor
    • MRF1
    • Protein g1
    see all
  • Function
    Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
  • Tissue specificity
    Detected in T-lymphocytes and peripheral blood mononuclear cells.
  • Sequence similarities
    Contains 2 EF-hand domains.
  • Post-translational
    modifications
    Phosphorylated on serine residues.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection > ruffle membrane. Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis.
  • Information by UniProt

References

ab173043 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up