Description

  • Product name

    Recombinant Human ICA69 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVV ASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRS QGFQDKTRAG
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      1 to 110

Specifications

Our Abpromise guarantee covers the use of ab116929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.

    Previously labelled as ICA1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 69 kDa islet cell autoantigen
    • Diabetes mellitus type I autoantigen
    • ICA 1
    • Ica1
    • ICA69
    • ICA69_HUMAN
    • ICAp69
    • Islet cell autoantigen 1
    • Islet cell autoantigen 1 (69kD)
    • Islet cell autoantigen 1 69kDa
    • Islet cell autoantigen 1 isoform
    • Islet cell autoantigen p69
    • OTTHUMP00000200933
    • OTTHUMP00000200934
    • OTTHUMP00000200941
    • OTTHUMP00000200993
    • p69
    see all
  • Function

    May play a role in neurotransmitter secretion.
  • Tissue specificity

    Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
  • Sequence similarities

    Contains 1 AH domain.
  • Cellular localization

    Cytoplasm > cytosol. Golgi apparatus membrane. Cytoplasmic vesicle > secretory vesicle membrane. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116928 at approximately 37.73 kDa.

References

ab116929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up