Description

  • Product name

    Recombinant Human ICAD protein
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMEVTGDAGVPESGEIRTLKPCLLRRNYSRE QHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLP SNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQ LKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRE TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIK KTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDP T
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      1 to 331
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names

    • A330085O09Rik
    • Caspase activated deoxyribonuclease inhibitor short form
    • DFF 1
    • DFF 45
    • DFF alpha
    • DFF-45
    • DFF1
    • DFF35
    • DFF45
    • DFFA
    • Dffa DNA fragmentation factor, alpha subunit
    • DFFA_HUMAN
    • DNA fragmentation factor 45 kDa subunit
    • DNA Fragmentation Factor Alpha Subunit
    • DNA fragmentation factor subunit alpha
    • DNA fragmentation factor, 45 kD, alpha subunit
    • DNA fragmentation factor, 45kDa, alpha polypeptide
    • DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1
    • DNA fragmentation factor, alpha subunit
    • DNAation factor 45 kDa subunit
    • H13
    • ICAD
    • ICAD L
    • ICAD S
    • Inhibitor of CAD
    • Inhibitor of Caspase Activated DNase
    • MGC143066
    • OTTHUMP00000001903
    • OTTHUMP00000001904
    • RP23 121D17.3
    see all
  • Function

    Inhibitor of the caspase-activated DNase (DFF40).
  • Sequence similarities

    Contains 1 CIDE-N domain.
  • Post-translational
    modifications

    Caspase-3 cleaves DFF45 at 2 sites to generate an active factor.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab173052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up