For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-icam1-protein-ab168688.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Cell Type Markers CD Adhesion
Share by email
Bioactive grade

Recombinant human ICAM1 protein (ab168688)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
  • Functional Studies - Recombinant human ICAM1 protein (ab168688)
  • SDS-PAGE - Recombinant human ICAM1 protein (ab168688)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 98% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Tags: Fc tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

ELISA
Product image
Human ICAM1 ELISA Kit (CD54) (ab174445)

View more associated products

Description

  • Product name

    Recombinant human ICAM1 protein
    See all ICAM1 proteins and peptides
  • Biological activity

    Measured by the ability of the immobilized protein to support the adhesion of PMA-stimulated HSB2 human peripheral blood acute lymphoblastic leukemia cells. When 5×104 cells/well are added to ab168688 coated plates (12.5 µg/ml with 100 µl/well), >60% will adhere after PMA 1 hour incubation at 37oC.
  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    P05362
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNR KVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQP VGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVR RDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRV LEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASV SVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGT EVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLE VAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPL PELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLS PRYE
    • Predicted molecular weight

      76 kDa including tags
    • Amino acids

      27 to 480
    • Tags

      Fc tag C-Terminus

Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab168688 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      SDS-PAGE

    • Form

      Lyophilized
    • Additional notes

      Measured by the ability of the immobilized protein to support the adhesion of PMA-stimulated HSB2 human peripheral blood acute lymphoblastic leukemia cells. When 5×104 cells/well are added to ab168688 coated plates (12.5 µg/ml with 100 µl/well), >60% will adhere after PMA 1 hour incubation at 37oC.
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

      pH: 7.4
      Constituents: 5% Trehalose, 0.75% Glycine, 0.6% Tris

      Storage buffer:
      Lyophilized from 0.22 µm filtered solution in 50 mM tris, 100 mM glycine, pH7.5. Normally Mannitol or Trehalose are added as protectants before lyophilization.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1000 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

    General Info

    • Alternative names

      • Antigen identified by monoclonal antibody BB2
      • BB 2
      • BB2
      • CD 54
      • CD_antigen=CD54
      • CD54
      • Cell surface glycoprotein P3.58
      • Human rhinovirus receptor
      • ICAM 1
      • ICAM-1
      • ICAM1
      • ICAM1_HUMAN
      • Intercellular adhesion molecule 1
      • intercellular adhesion molecule 1 (CD54)
      • intercellular adhesion molecule 1 (CD54), human rhinovirus receptor
      • Major group rhinovirus receptor
      • MALA 2
      • MALA2
      • MyD 10
      • MyD10
      • P3.58
      • Surface antigen of activated B cells
      • Surface antigen of activated B cells, BB2
      see all
    • Function

      ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.
    • Sequence similarities

      Belongs to the immunoglobulin superfamily. ICAM family.
      Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    • Post-translational
      modifications

      Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis.
    • Cellular localization

      Membrane.
    • Target information above from: UniProt accession P05362 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
      SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
      Human ICAM-1, Fc Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 98%.
    • Functional Studies - Recombinant human ICAM1 protein (ab168688)
      Functional Studies - Recombinant human ICAM1 protein (ab168688)
      Immobilized Human ITGALB2, His tag at 5 µg/mL (100 µL/well) can bind Human ICAM-1, Fc Tag with a linear range of 0.082-1.28 µg/mL.
    • SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
      SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
      SDS-PAGE analysis of reduced ab168688 stained overnight with Coomassie Blue.
      Protein migrates as 100-110 kDa in reduced SDS-PAGE resulting from glycosylation.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab168688? Please let us know so that we can cite the reference in this datasheet.

    ab168688 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab168688.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.