Bioactive grade

Recombinant human ICAM1 protein (ab168688)

Submit a review Submit a question
SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
  • Functional Studies - Recombinant human ICAM1 protein (ab168688)
  • SDS-PAGE - Recombinant human ICAM1 protein (ab168688)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 98% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Tags: Fc tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

Description

  • Product name

    Recombinant human ICAM1 protein
    See all ICAM1 proteins and peptides

  • Biological activity

    Measured by the ability of the immobilized protein to support the adhesion of PMA-stimulated HSB2 human peripheral blood acute lymphoblastic leukemia cells. When 5×104 cells/well are added to ab168688 coated plates (12.5 µg/ml with 100 µl/well), >60% will adhere after PMA 1 hour incubation at 37oC.

  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg

  • Expression system

    HEK 293 cells

  • Accession

    P05362

  • Protein length

    Protein fragment

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Human

    • Sequence

      AQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNR KVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQP VGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVR RDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRV LEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASV SVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGT EVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLE VAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPL PELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLS PRYE

    • Predicted molecular weight

      76 kDa including tags

    • Amino acids

      27 to 480

    • Tags

      Fc tag C-Terminus

Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab168688 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      SDS-PAGE

    • Form

      Lyophilized

    • Additional notes

      Measured by the ability of the immobilized protein to support the adhesion of PMA-stimulated HSB2 human peripheral blood acute lymphoblastic leukemia cells. When 5×104 cells/well are added to ab168688 coated plates (12.5 µg/ml with 100 µl/well), >60% will adhere after PMA 1 hour incubation at 37oC.
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

      pH: 7.4
      Constituents: 5% Trehalose, 0.75% Glycine, 0.6% Tris

      Storage buffer:
      Lyophilized from 0.22 µm filtered solution in 50 mM tris, 100 mM glycine, pH7.5. Normally Mannitol or Trehalose are added as protectants before lyophilization.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1000 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

    General Info

    • Alternative names

      • Antigen identified by monoclonal antibody BB2
      • BB 2
      • BB2
      • CD 54
      • CD_antigen=CD54
      • CD54
      • Cell surface glycoprotein P3.58
      • Human rhinovirus receptor
      • ICAM 1
      • ICAM-1
      • ICAM1
      • ICAM1_HUMAN
      • Intercellular adhesion molecule 1
      • intercellular adhesion molecule 1 (CD54)
      • intercellular adhesion molecule 1 (CD54), human rhinovirus receptor
      • Major group rhinovirus receptor
      • MALA 2
      • MALA2
      • MyD 10
      • MyD10
      • P3.58
      • Surface antigen of activated B cells
      • Surface antigen of activated B cells, BB2
      see all

    • Function

      ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.

    • Sequence similarities

      Belongs to the immunoglobulin superfamily. ICAM family.
      Contains 5 Ig-like C2-type (immunoglobulin-like) domains.

    • Post-translational
      modifications

      Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis.

    • Cellular localization

      Membrane.
    • Information by UniProt

    Images

    • SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
      SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
      Human ICAM-1, Fc Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 98%.
    • Functional Studies - Recombinant human ICAM1 protein (ab168688)
      Functional Studies - Recombinant human ICAM1 protein (ab168688)
      Immobilized Human ITGALB2, His tag at 5 µg/mL (100 µL/well) can bind Human ICAM-1, Fc Tag with a linear range of 0.082-1.28 µg/mL.
    • SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
      SDS-PAGE - Recombinant human ICAM1 protein (ab168688)
      SDS-PAGE analysis of reduced ab168688 stained overnight with Coomassie Blue.
      Protein migrates as 100-110 kDa in reduced SDS-PAGE resulting from glycosylation.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab168688? Please let us know so that we can cite the reference in this datasheet.

    ab168688 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab168688.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com