Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFELKVFEVHVRPKKLAVEPKGS LEVNCSTTCNQPEVGGLETSLDKILLDEQAQWKHYLVSNISHDTVLQCHF TCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLD SLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAV LDLMSRGGNIFHKHSAPKMLEIYEPVSDSQ
    • Molecular weight

      26 kDa including tags
    • Amino acids

      25 to 223
    • Tags

      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Other

  • Purity

    > 90 % SDS-PAGE.
    ab134869 was expressed in E. coli as inclusion bodies, refolded using a temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: contains NaCl, EDTA, KCl, arginine, DTT and glycerol.

General Info

  • Alternative names

    • CD102
    • CD102 antigen
    • ICAM 2
    • Intercellular adhesion molecule 2
    • Ly60
    see all
  • Relevance

    ICAM2 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin like C2 type domains, and bind to the leukocyte adhesion LFA1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA1 dependent cell adhesion. It mediates adhesive interactions important for antigen specific immune response, NK cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance.
  • Cellular localization

    Membrane; Single-pass type I membrane protein

References

ab134869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up