Recombinant Human ICB1 protein (ab160504)

Overview

  • Product name

    Recombinant Human ICB1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPW HSLILRPQYEIQAIMHIFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQ DSCPQEGPQAR
    • Amino acids

      1 to 111
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as C1orf38

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Basement membrane induced
    • Chromosome 1 open reading frame 38
    • ICB 1
    • ICB1
    • Induced by contact to basement membrane 1 protein
    • Protein ICB 1
    • Protein ICB-1
    • Protein THEMIS2
    • THEMIS2
    • THMS2_HUMAN
    • Thymocyte expressed molecule involved in selection protein 2
    • Thymocyte-expressed molecule involved in selection protein 2
    see all
  • Function

    May constitute a control point in macrophage inflammatory response, promoting LPS-induced TNF production.
  • Tissue specificity

    Expressed in different endometrial adenocarcinoma cell lines and various other cell lines apart from the prostate cell line LNCaP and the ovarian cancer cell line BG1.
  • Sequence similarities

    Belongs to the themis family.
  • Post-translational
    modifications

    Phosphorylation at Tyr-632 is induced by LPS.
  • Information by UniProt

Images

  • ab160504 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up