Recombinant human ICOS protein (Fc Chimera Active) (ab215028)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level: < 0.060 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human ICOS protein (Fc Chimera Active)
See all ICOS proteins and peptides -
Biological activity
Measured by its ability to inhibit human T cell proliferation induced by human CD275:Fc in the presence of anti-CD3.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
< 0.060 Eu/µg -
Expression system
CHO cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKG SGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFK VTLTGGYLHIYESQLCCQL -
Amino acids
21 to 139 -
Additional sequence information
Extracellular domain, fused to the N-terminus of the Fc region of mouse IgG2a. (NP_036224.1).
-
Specifications
Our Abpromise guarantee covers the use of ab215028 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: PBS
Lyophilized from 0.2 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- Activation inducible lymphocyte immunomediatory molecule
- Activation-inducible lymphocyte immunomediatory molecule
- AILIM
see all -
Function
Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes. -
Tissue specificity
Activated T-cells. Highly expressed on tonsillar T-cells, which are closely associated with B-cells in the apical light zone of germinal centers, the site of terminal B-cell maturation. Expressed at lower levels in thymus, lung, lymph node and peripheral blood leukocytes. Expressed in the medulla of fetal and newborn thymus. -
Involvement in disease
Immunodeficiency, common variable, 1 -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab215028 has not yet been referenced specifically in any publications.