Recombinant human ICOS protein (Fc Chimera Active) (ab215028)

Description

  • Product name

    Recombinant human ICOS protein (Fc Chimera Active)
    See all ICOS proteins and peptides
  • Biological activity

    Measured by its ability to inhibit human T cell proliferation induced by human CD275:Fc in the presence of anti-CD3.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKG SGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFK VTLTGGYLHIYESQLCCQL
    • Amino acids

      21 to 139
    • Additional sequence information

      Extracellular domain, fused to the N-terminus of the Fc region of mouse IgG2a. (NP_036224.1).

Specifications

Our Abpromise guarantee covers the use of ab215028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • Activation inducible lymphocyte immunomediatory molecule
    • Activation-inducible lymphocyte immunomediatory molecule
    • AILIM
    • CD278
    • CD278 antigen
    • CD28-related Protein-1
    • CRP1
    • CVID1
    • ICOS
    • ICOS_HUMAN
    • Inducible costimulator
    • Inducible T cell co stimulator
    • Inducible T-cell costimulator
    • MGC39850
    see all
  • Function

    Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes.
  • Tissue specificity

    Activated T-cells. Highly expressed on tonsillar T-cells, which are closely associated with B-cells in the apical light zone of germinal centers, the site of terminal B-cell maturation. Expressed at lower levels in thymus, lung, lymph node and peripheral blood leukocytes. Expressed in the medulla of fetal and newborn thymus.
  • Involvement in disease

    Immunodeficiency, common variable, 1
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab215028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up