Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGA RLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDY IRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDR ILCRLEESGGGGSPGRRRRRRRRRRR
    • Molecular weight

      19 kDa including tags
    • Amino acids

      2 to 155

Associated products

Specifications

Our Abpromise guarantee covers the use of ab134896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Protein transduction for epithelial cells in vitro cell differentiation
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134896 was expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology, chromatographically purified and sterile-filtered.
  • Form

    Liquid
  • Additional notes

    Protein transduction for epithelial cells in vitro cell differentiation
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, 3.4% DL-Arginine

    Buffer contains: Sodium chloride, Potassium chloride and Glycerol.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • bHLHb24
    • Class B basic helix-loop-helix protein 24
    • dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein)
    • DNA binding protein inhibitor ID 1
    • DNA binding protein inhibitor ID1
    • DNA-binding protein inhibitor ID-1
    • Dominant negative helix loop helix protein
    • ID
    • ID 1
    • ID1
    • ID1_HUMAN
    • Inhibitor of Differentiation 1
    • Inhibitor of DNA binding 1
    • inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
    see all
  • Function

    ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Developmental stage

    Expression correlates with proliferation in some types of cells.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

References

ab134896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up