Description

  • Product name

    Recombinant human IDH1 (mutated R132 H) protein
    See all IDH1 proteins and peptides
  • Biological activity

    Specific Activity: 53 pmol/min/μg.
    Assay conditions: ab198123 reductive activity was measured in 200 μl reaction containing 25 mM Tris (pH 7.4), 150 mM NaCl, 10 mM MgCl2, 0.03% BSA, 1 mM -Ketoglutarate, 10 μM NADPH and IDH. Depletion of NADPH was monitored over time at 340 nm.
    Depletion of NADPH was monitored continuously at Abs340 nm for 20 min. Molar extinction coefficient of NADPH is 6,200
    M-1cm-1.

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRD ATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIR NILGGTVFREAIICKNIPRLVSGWVKPIIIGHHAYGDQYRATDFVVPGPG KVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA LSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRL IDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNK ELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDK LGENLKIKLAQAKLDYKDDDDK
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      1 to 414
    • Modifications

      mutated R132 H
    • Tags

      DDDDK tag C-Terminus
    • Additional sequence information

      GenBank Accession No. NM_005896

Specifications

Our Abpromise guarantee covers the use of ab198123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Isocitrate dehydrogenase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.04% Tween, 20% Glycerol, 0.02% Potassium chloride

    Also contains 80 µg/ml DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Cytosolic NADP isocitrate dehydrogenase
    • Cytosolic NADP-isocitrate dehydrogenase
    • Epididymis luminal protein 216
    • Epididymis secretory protein Li 26
    • HEL-216
    • HEL-S-26
    • ICDH
    • IDCD
    • IDH
    • IDH1
    • IDHC_HUMAN
    • IDP
    • IDPC
    • Isocitrate dehydrogenase (NADP(+)) 1 cytosolic
    • Isocitrate dehydrogenase [NADP] cytoplasmic
    • Isocitrate dehydrogenase 1 (NADP+) soluble
    • NADP dependent isocitrate dehydrogenase cytosolic
    • NADP dependent isocitrate dehydrogenase peroxisomal
    • NADP(+)-specific ICDH
    • Oxalosuccinate decarboxylase
    • PICD
    see all
  • Involvement in disease

    Glioma
    Genetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma. Mutations of Arg-132 to Cys, Gly or His abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate.
  • Sequence similarities

    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications

    Acetylation at Lys-374 dramatically reduces catalytic activity.
  • Cellular localization

    Cytoplasm. Peroxisome.
  • Information by UniProt

Images

  • Specific activity of ab198123 was determined to be 53 pmol/min/μg

  • 4-20% SDS-PAGE analysis of 1.6 µg ab198123 with Coomassie staining.

References

ab198123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up