Description

  • Product name

    Recombinant human IDH1 protein
    See all IDH1 proteins and peptides
  • Biological activity

    Specific Activity: 5600 pmol/min/µg.

     

    Assay Conditions: Reaction was conducted in 50 mM Tris (pH 7.4), 10 mM MgCl2, 200 µM DL-isocitrate, and 200 µM NADP. Incubate for 30 minutes at room temperature. Read at Abs340.

  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRD ATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIR NILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPG KVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA LSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRL IDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNK ELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDK LGENLKIKLAQAKL
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      1 to 414
    • Tags

      DDDDK tag C-Terminus
    • Additional sequence information

      GenBank Accession No. NM_005896.

Specifications

Our Abpromise guarantee covers the use of ab198096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Isocitrate dehydrogenase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 10% Glycerol

    Contains 90 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Cytosolic NADP isocitrate dehydrogenase
    • Cytosolic NADP-isocitrate dehydrogenase
    • Epididymis luminal protein 216
    • Epididymis secretory protein Li 26
    • HEL-216
    • HEL-S-26
    • ICDH
    • IDCD
    • IDH
    • IDH1
    • IDHC_HUMAN
    • IDP
    • IDPC
    • Isocitrate dehydrogenase (NADP(+)) 1 cytosolic
    • Isocitrate dehydrogenase [NADP] cytoplasmic
    • Isocitrate dehydrogenase 1 (NADP+) soluble
    • NADP dependent isocitrate dehydrogenase cytosolic
    • NADP dependent isocitrate dehydrogenase peroxisomal
    • NADP(+)-specific ICDH
    • Oxalosuccinate decarboxylase
    • PICD
    see all
  • Involvement in disease

    Glioma
    Genetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma. Mutations of Arg-132 to Cys, Gly or His abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate.
  • Sequence similarities

    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications

    Acetylation at Lys-374 dramatically reduces catalytic activity.
  • Cellular localization

    Cytoplasm. Peroxisome.
  • Information by UniProt

Images

  • Activity assay using ab198096.

  • 10% SDS-PAGE analysis of 2.5 µg ab198096 with Coomassie staining.

References

ab198096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up