Description

  • Product name

    Recombinant Human IDH1 protein (His tag)
    See all IDH1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDA TNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRN ILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGK VEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMAL SKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLI DDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGK TVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKE LAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKL GENLKIKLAQAKL
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      2 to 414
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (NP_005887).

Specifications

Our Abpromise guarantee covers the use of ab219691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Isocitrate dehydrogenase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 0.05% Brij, 0.02% DTT

    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Cytosolic NADP isocitrate dehydrogenase
    • Cytosolic NADP-isocitrate dehydrogenase
    • Epididymis luminal protein 216
    • Epididymis secretory protein Li 26
    • HEL-216
    • HEL-S-26
    • ICDH
    • IDCD
    • IDH
    • IDH1
    • IDHC_HUMAN
    • IDP
    • IDPC
    • Isocitrate dehydrogenase (NADP(+)) 1 cytosolic
    • Isocitrate dehydrogenase [NADP] cytoplasmic
    • Isocitrate dehydrogenase 1 (NADP+) soluble
    • NADP dependent isocitrate dehydrogenase cytosolic
    • NADP dependent isocitrate dehydrogenase peroxisomal
    • NADP(+)-specific ICDH
    • Oxalosuccinate decarboxylase
    • PICD
    see all
  • Involvement in disease

    Glioma
    Genetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma. Mutations of Arg-132 to Cys, Gly or His abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate.
  • Sequence similarities

    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications

    Acetylation at Lys-374 dramatically reduces catalytic activity.
  • Cellular localization

    Cytoplasm. Peroxisome.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab219691 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 47.5 kDa.

References

ab219691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up