Description

  • Product name

    Recombinant human IDH2 protein
    See all IDH2 proteins and peptides
  • Biological activity

    Specific Activity: 14,200 pmol/min/µg.

     

    Assay Conditions:
    The reaction mixture contained 50 mM Tris, pH 7.4, 5 mM MgCl2, 200 µM DL-isocitrate, 200 µM NADP+, and various amount of ab198092 in a volume of 200 µL. Reactions were initiated with the addition of ab198092, and the increase in NADPH absorbance at 340 nm was continuously monitored for 7 min. Molar extinction coefficient of NADPH is 6,220 M-1cm-1.
    .

  • Purity

    >= 59 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPV VEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDS ALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFRE PIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKD GSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMST KNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEK VCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALG RQDYKDDDDK
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      1 to 452
    • Tags

      DDDDK tag C-Terminus
    • Additional sequence information

      NM_002168.

Specifications

Our Abpromise guarantee covers the use of ab198092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol, 0.05% DTT

    Contains 90 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • D2HGA2
    • ICD-M
    • IDH
    • IDH2
    • IDHM
    • IDHP_HUMAN
    • IDP
    • IDPM
    • Isocitrate dehydrogenase [NADP], mitochondrial
    • Isocitrate dehydrogenase 2 (NADP+), mitochondrial
    • mNADP-IDH
    • NADP(+)-specific ICDH
    • Oxalosuccinate decarboxylase
    see all
  • Function

    Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.
  • Involvement in disease

    D-2-hydroxyglutaric aciduria 2
    Glioma
    enetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma.
  • Sequence similarities

    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications

    Acetylation at Lys-413 dramatically reduces catalytic activity. Deacetylated by SIRT3.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • Activity assay of ab198092.

  • 10% SDS-PAGE analysis of 1.4 µg ab198092 with Coomassie staining.

References

This product has been referenced in:

  • Intlekofer AM  et al. Acquired resistance to IDH inhibition through trans or cis dimer-interface mutations. Nature 559:125-129 (2018). Read more (PubMed: 29950729) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up