Description

  • Product name

    Recombinant human IDO-2 protein (His tag)
    See all IDO-2 proteins and peptides
  • Biological activity

    IDO-2 activity was confirmed using an IDO2 inhibitor screening assay Kit

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIA NK LPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEG EAQPAEVL PRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGFL EIGNLETIISFPGGESLHGF ILVTALVEKEAVPGIKALVQATNAILQP NQEALLQALQRLRLSIQDITKTLGQMHDYVDP DIFYAGIRIFLSGWKD NPAMPAGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSK ESGD FLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALA ELRSYH ITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMS FLKSVRDKTLESILHPRG
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      15 to 420
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Expressed in the presence of hemin (NM_194294).

Specifications

Our Abpromise guarantee covers the use of ab216243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Protein previously labeled as INDOL1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.02% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 3-dioxygenase 2
    • 3-dioxygenase-like protein 1
    • EC 1.13.11.
    • I23O2_HUMAN
    • IDO 2
    • IDO-2
    • Ido2
    • INDOL 1
    • Indoleamine 2
    • Indoleamine 2,3 dioxygenase 2
    • Indoleamine 2,3 dioxygenase like 1 protein
    • Indoleamine 2,3 dioxygenase like protein 1
    • Indoleamine pyrrole 2,3 dioxygenase like 1
    • Indoleamine pyrrole 2,3 dioxygenase like protein 1
    • Indoleamine-pyrrole 2
    see all
  • Function

    Catalyzes the first and rate-limiting step in the kynurenine pathway of tryptophan catabolism.
  • Tissue specificity

    Detected in liver, small intestine, spleen, placenta, thymus, lung, brain, kidney, and colon.
  • Pathway

    Amino-acid degradation; L-tryptophan degradation via kynurenine pathway; L-kynurenine from L-tryptophan: step 1/2.
  • Sequence similarities

    Belongs to the indoleamine 2,3-dioxygenase family.
  • Information by UniProt

Images

  • Activity assay for ab216243.

  • 4-20% SDS-PAGE analysis of ab216243 (4.2 µg).

References

ab216243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up