Description

  • Product name

    Recombinant Human IDOL protein
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHDYKDDDDKLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGI IEVDYFGLQFTGSKGESLWLNLRNRISQQMDGLAPYRLKLRVKFFVEPHL ILQEQTRHIFFLHIKEALLAGHLLCSPEQAVELSALLAQTKFGDYNQNTA KYNYEELCAKELSSATLNSIVAKHKELEGTSQASAEYQVLQIVSAMENYG IEWHSVRDSEGQKLLIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKN VYLTVTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMM QYSRDLKGHLASLFLNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVV DLVSRNNQSPSHSPLKSSESSMNCSSCEGLSCQQTRVLQEKLRKLKEAML CMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTH TSLLNLTVI
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      2 to 445
    • Tags

      His-DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.017% Potassium chloride, 20% Glycerol

    Contains 80 µg/ml DDDDK peptide

General Info

  • Alternative names

    • BM-023
    • BZF1
    • E3 ubiquitin protein ligase MYLIP
    • E3 ubiquitin-protein ligase MYLIP
    • Idol
    • Inducible degrader of the LDL-receptor
    • Lipoprotein receptor
    • MIR
    • MYLIP
    • MYLIP_HUMAN
    • Myosin regulatory light chain interacting protein
    • PP5242
    see all
  • Function

    E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of myosin regulatory light chain (MRLC), LDLR, VLDLR and LRP8. Proteasomal degradation of MRLC leads to inhibit neurite outgrowth in presence of NGF by counteracting the stabilization of MRLC by saposin-like protein (CNPY2/MSAP) and reducing CNPY2-stimulated neurite outgrowth. Acts as a sterol-dependent inhibitor of cellular cholesterol uptake by mediating ubiquitination and subsequent degradation of LDLR.
  • Tissue specificity

    Ubiquitously expressed.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 FERM domain.
    Contains 1 RING-type zinc finger.
  • Developmental stage

    Expressed in fetal tissues and higher levels were detected in placenta and fetal lung.
  • Domain

    The RING domain mediates ubiquitination and the neurite outgrowth inhibitory activity.
  • Post-translational
    modifications

    Autoubiquitinated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE with Coomassie staining

    Lane 1: 0.9 µg ab198638
    Lane 2: Protein marker

References

ab198638 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up