Overview

  • Product name
    Recombinant Human IFI27 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSA MGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLT KFILGSIGSAIAAVIARFY
    • Amino acids
      1 to 119
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310061N23Rik
    • FAM 14D
    • FAM14D
    • IFI 27
    • IFI27
    • IFI27_HUMAN
    • Interferon alpha induced 11.5 kDa protein
    • Interferon alpha inducible protein 27
    • Interferon alpha-induced 11.5 kDa protein
    • Interferon alpha-inducible protein 27
    • interferon alpha-inducible protein 27, mitochondrial
    • Interferon inducible protein 27
    • interferon-stimulated gene 12
    • Interferon-stimulated gene 12a protein
    • ISG 12
    • ISG12
    • ISG12(a)
    • ISG12(a) protein
    • ISG12A
    • mitochondrial
    • p27
    see all
  • Function
    Promotes cell death. Mediates IFN-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9.
  • Sequence similarities
    Belongs to the IFI6/IFI27 family.
  • Cellular localization
    Mitochondrion. Membrane.
  • Information by UniProt

Images

  • ab158725 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up