Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKY SVGIHNLLAYVKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGN FAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALL KCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATKNHKP FSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQ TYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMY IEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAII HYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLE GNMNEALEYYERALRLAADFENSVRQGP
    • Molecular weight

      82 kDa including tags
    • Amino acids

      1 to 478

Specifications

Our Abpromise guarantee covers the use of ab152468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C56
    • G10P1
    • GARG 16
    • GARG16
    • IFI 56
    • IFI 56K
    • IFI-56K
    • IFI56
    • IFIT-1
    • Ifit1
    • IFIT1_HUMAN
    • IFNAI1
    • Interferon alpha inducible protein (MW 56kD)
    • Interferon induced 56 kDa protein
    • Interferon induced protein 56
    • Interferon inducible mRNA 561
    • Interferon-induced 56 kDa protein
    • Interferon-induced protein with tetratricopeptide repeats 1
    • ISG56
    • OTTHUMP00000020062
    • P56
    • RNM561
    see all
  • Sequence similarities

    Belongs to the IFIT family.
    Contains 10 TPR repeats.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152468 stained with Coomassie Blue.

References

ab152468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up