Recombinant Human IFIT3 / P60 protein (ab152469)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFK ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY AWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDCEEGWTQLKCG RNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAI ELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKF YRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQMQNTGESEA SGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKD QPQNVSENLLPQNAPNYWYLQGLIHKQNGDLLQAAKCYEKELGRLLRDAP SGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN
    • Molecular weight
      82 kDa including tags
    • Amino acids
      1 to 490

Specifications

Our Abpromise guarantee covers the use of ab152469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Protein previously labeled as IFIT3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CIG 49
    • CIG49
    • GARG 49
    • IFI-60K
    • IFI60
    • IFI60K
    • IFIT-3
    • IFIT-4
    • Ifit3
    • IFIT3_HUMAN
    • IFIT4
    • Interferon induced 60 kDa protein
    • Interferon induced protein 60
    • Interferon induced protein with tetratricopeptide repeats 3
    • Interferon-induced 60 kDa protein
    • Interferon-induced protein with tetratricopeptide repeats 3
    • Interferon-induced protein with tetratricopeptide repeats 4
    • IRG2
    • ISG-60
    • ISG60
    • P60
    • Retinoic acid induced gene G protein
    • Retinoic acid-induced gene G protein
    • RIG G
    • RIG-G
    • RIGG
    • RP11-149I23.4
    see all
  • Sequence similarities
    Belongs to the IFIT family.
    Contains 8 TPR repeats.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152469 stained with Coomassie Blue.

References

ab152469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up