Overview

  • Product name

    Recombinant Human IFIT3/P60 protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSEVTKNSLEKILPQLKCHFTWNLFKE DSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAALECLRQA EELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKF SNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLA IAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGE QFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYL YHQIGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLN PLNAYSDLAEFLETECYQTPFNKEVPDAEKQQSHQRYCNLQKYNGKSEDT AVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQ NGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSS SPRELLSNSEQLN
    • Molecular weight

      58 kDa including tags
    • Amino acids

      1 to 490
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No.: NP_001540

Specifications

Our Abpromise guarantee covers the use of ab201888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 80 % SDS-PAGE.
    ab201888 was purified using conventional chromatography.
  • Form

    Liquid
  • Additional notes

    Protein previously labeled as IFIT3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 78% PBS, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • CIG 49
    • CIG49
    • GARG 49
    • IFI-60K
    • IFI60
    • IFI60K
    • IFIT-3
    • IFIT-4
    • Ifit3
    • IFIT3_HUMAN
    • IFIT4
    • Interferon induced 60 kDa protein
    • Interferon induced protein 60
    • Interferon induced protein with tetratricopeptide repeats 3
    • Interferon-induced 60 kDa protein
    • Interferon-induced protein with tetratricopeptide repeats 3
    • Interferon-induced protein with tetratricopeptide repeats 4
    • IRG2
    • ISG-60
    • ISG60
    • P60
    • Retinoic acid induced gene G protein
    • Retinoic acid-induced gene G protein
    • RIG G
    • RIG-G
    • RIGG
    • RP11-149I23.4
    see all
  • Sequence similarities

    Belongs to the IFIT family.
    Contains 8 TPR repeats.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab201888 (3 µg)

References

ab201888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up