Description

  • Product name

    Recombinant human Ifnb1 protein (Active)
  • Biological activity

    Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 3.0 x 107 IU/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF QKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKT VLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEI LRNFYFINRLTGYLRN
    • Predicted molecular weight

      20 kDa
    • Amino acids

      22 to 187
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab242252 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 2% Human serum albumin, 3% Mannitol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Beta-interferon
    • Fibroblast interferon
    • Ifb
    • IFF
    • IFN beta
    • IFN, fibroblast
    • IFNB
    • Ifnb1
    • Interferon beta
    • interferon beta 1, fibroblast
    • MGC96956
    • OTTHUMP00000021131
    • RP23-19G2.2
    see all
  • Relevance

    The mammalian type I Inteferons (IFN1) are produced in response to viral infection and other inducers. They are divided into alpha and beta subtypes leukocytes and fibroblasts reactivity. The human IFN alphas are encoded by a family of at least 15 different genes, while IFN beta is the unique member of its subtype. There is approximately 50% amino acid homology between the alpha and beta subtypes. Both IFN subtypes are pleiotropic cytokines and have a similar range of biological activities. Differences between alpha subtypes, and between IFN alpha and betas, are in potency and cell type specific activities. In particular, IFN beta elicits a markedly higher antiproliferation response in some cell types such as, embryonal carcinoma, melanoma and melanocytes than do IFN alphas. Higher potency of IFN beta in treatment of multiple sclerosis and certain cancers has been observed. Type I IFNs signal through binding to a common cell surface receptor. Two chains of the receptor, IFNAR1 and IFNAR2, have been identified. Both chains are necessary for function and in the absence of either there is neither high affinity binding nor biological activity. The intracellular portions of the receptor subunits are bound by tyrosine kinases, Jak1 and Tyk2, members of the Janus kinase family. Upon ligand binding these kinases are activated and phosphorylate members of the STAT family of transcription factors, as well as IFNAR1 and 2.
  • Cellular localization

    Secreted

Images

  • SDS-PAGE analysis of ab242252.

References

ab242252 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up