Recombinant Human IFNGR1 protein (His tag) (ab235874)
Key features and details
- Expression system: Baculovirus infected insect cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µl
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human IFNGR1 protein (His tag)
See all IFNGR1 proteins and peptides -
Purity
> 90 % SDS-PAGE.
ab235874 was expressed in insect cell and affinity purified. -
Endotoxin level
< 1.000 Eu/µl -
Expression system
Baculovirus infected insect cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYG VKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSE EFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTC YIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSA EGVLHVWGVTTEKSKEVCITIFNSSIKGHHHHHH -
Predicted molecular weight
27 kDa including tags -
Amino acids
18 to 245 -
Tags
His tag C-Terminus -
Additional sequence information
Extracellular domain. NP_000407.
-
Associated products
-
Related Buffer
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab235874 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: PBS, 10% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- Antiviral Protein Type II
- Antiviral protein, type 2
- AVP type II
see all -
Function
Receptor for interferon gamma. Two receptors bind one interferon gamma dimer. -
Involvement in disease
Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD) [MIM:209950]; also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. -
Sequence similarities
Belongs to the type II cytokine receptor family.
Contains 2 fibronectin type-III domains.
Contains 2 Ig-like C2-type (immunoglobulin-like) domains. -
Post-translational
modificationsPhosphorylated at Ser/Thr residues. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab235874 has not yet been referenced specifically in any publications.