Description

  • Product name

    Recombinant Human IFNGR1 protein (His tag)
    See all IFNGR1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab235874 was expressed in insect cell and purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µl
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYG VKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSE EFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTC YIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSA EGVLHVWGVTTEKSKEVCITIFNSSIKGHHHHHH
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      18 to 245
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain. NP_000407.

Specifications

Our Abpromise guarantee covers the use of ab235874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • Antiviral Protein Type II
    • Antiviral protein, type 2
    • AVP type II
    • AVP, type 2
    • CD 119
    • CD119
    • CD119 antigen
    • CDw119
    • FLJ45734
    • IFN gamma R
    • IFN gamma R alpha
    • IFN gamma R1
    • IFN-gamma receptor 1
    • IFN-gamma-R1
    • IFNG R1
    • IFNGR
    • IFNGR 1
    • IFNGR1
    • Immune interferon receptor 1
    • Immune interferon receptor for
    • INGR1_HUMAN
    • Interferon gamma receptor 1
    • Interferon gamma receptor alpha chain
    • Interferon gamma receptor alpha chain precursor
    see all
  • Function

    Receptor for interferon gamma. Two receptors bind one interferon gamma dimer.
  • Involvement in disease

    Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD) [MIM:209950]; also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
  • Sequence similarities

    Belongs to the type II cytokine receptor family.
    Contains 2 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Phosphorylated at Ser/Thr residues.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg ab235874.

References

ab235874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up