Description

  • Product name

    Recombinant Human IFNK protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSS MSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQ HTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDENENEDMKEMKENEMKPS EARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKF TALFRRK
    • Amino acids

      1 to 207
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • IFN kappa
    • IFN-kappa
    • Ifnk
    • IFNK_HUMAN
    • Interferon kappa
    see all
  • Function

    May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon-stimulated response element signaling pathway. It is able to directly modulate cytokine release from monocytes and dendritic cells. Binds heparin.
  • Tissue specificity

    Expressed in keratinocytes, monocytes and in resting dendritic cells.
  • Sequence similarities

    Belongs to the alpha/beta interferon family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab163402 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Functional Studies
Recombinant IFNK was titrated onto a reporter cell line (HEK293-ISRE-luc clone 3C11), in which firefly luciferase expression is driven by interferon-stimulated response elements (ISREs) (Bridgeman et al. 2015, Science 349:1228-1232). Recombinant IFNA2 was included as a positive control. Luciferase activity was quantified 24 h post stimulation. The lack of luciferase signal from cells stimulated with IFNK indicates that JAK/STAT signalling downstream of the type I IFN receptor was not activated. Therefore, this recombinant protein shows no bioactivity when assayed using this system.

Rachel Rigby

Verified customer

Submitted Feb 27 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up