Overview

  • Product name

    Recombinant Human IFRD1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIET MSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQ AALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSDEQRAAAALAS VLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFI ATDDITELYSTLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTL LLTICPINEVKKKLEMHFHKLPSLLSCDDVNMRIAAGESLALLFELARGI ESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERD FPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFE LGPPVMLDAATLKTMKISRFERHLYNSAAFKARTKARSKCRDKRADVGEF F
    • Molecular weight

      77 kDa including tags
    • Amino acids

      1 to 451

Specifications

Our Abpromise guarantee covers the use of ab152474 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 12 O tetradecanoylphorbol 13 acetate induced sequence 7
    • IFRD1
    • IFRD1_HUMAN
    • interferon related developmental regulator 1
    • Interferon-related developmental regulator 1
    • Nerve growth factor inducible protein PC4
    • Nerve growth factor-inducible protein PC4
    • PC4
    • Pheochromocytoma cell 4
    • TIS7
    • TPA induced sequence 7
    see all
  • Function

    Could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. May be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.
  • Tissue specificity

    Expressed in a variety of tissues.
  • Sequence similarities

    Belongs to the IFRD family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152474 stained with Coomassie Blue.

References

ab152474 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152474.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up