Overview

  • Product name

    Recombinant Human IGBP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLE KAAEMLSQLDLFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLD HLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVA MASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRW IDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMA QAKVFGAGYPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQ EEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG
    • Molecular weight

      63 kDa including tags
    • Amino acids

      1 to 339

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alpha 4
    • B cell signal transduction molecule alpha 4
    • B-cell signal transduction molecule alpha 4
    • bA351K23.1
    • bA351K23.1 (immunoglobulin binding protein 1 (CD79A) )
    • CD79a binding protein 1
    • CD79a-binding protein 1
    • IBP 1
    • IBP1
    • IGBP 1
    • Igbp1
    • IGBP1_HUMAN
    • Immunoglobulin (CD79A) binding protein 1
    • Immunoglobulin binding protein 1
    • Immunoglobulin-binding protein 1
    • Protein alpha 4
    • Protein alpha-4
    • Protein phosphatase 2/4/6 regulatory subunit
    • Protein phosphatase 2A regulatory subunit alpha 4
    • Renal carcinoma antigen NY REN 16
    • Renal carcinoma antigen NY-REN-16
    see all
  • Function

    Associated to surface IgM-receptor; may be involved in signal transduction. May be involved in regulation of the catalytic activity of type 2A-related serine/threonine phosphatases.
  • Tissue specificity

    Ubiquitously expressed with highest levels in heart, skeletal muscle and pancreas.
  • Involvement in disease

    Defects in IGBP1 are the cause of agenesis of the corpus callosum with mental retardation-ocular coloboma-micrognathia (ACCMRCM) [MIM:300472].
  • Sequence similarities

    Belongs to the IGBP1/TAP42 family.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132577 stained with Coomassie Blue.

References

ab132577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up