Recombinant human IGF1 protein (Active) (ab155614)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag N-Terminus
- Suitable for: SDS-PAGE, Functional Studies, ELISA
Achieve higher consistency and quality standards with a premium grade bioactive protein
- High batch-to-batch consistency
- Optimal bioactivity
- Guaranteed identical to human native proteins
- >95% purity
- Ultra-low endotoxin levels: <0.005 Eu/µg
- Carrier and tag free
Description
-
Product name
Recombinant human IGF1 protein (Active)
See all IGF1 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized Human IGF-I R, His Tag (ab155622) at 5 μg/mL (100 μL/well) can bind Human IGF-I, Fc Tag (ab155614) with a linear range of 0.039-0.313 μg/mL.
Measured by its binding ability in a functional ELISA. Immobilized Recombinant human IGF1 protein (Active) (ab155614) at 5 μg/mL (100 μL/well) can bind Recombinant Human IGFBP3 protein (ab155611) with a linear range of 0.031-0.5 μg/mL.
-
Purity
> 98 % SDS-PAGE.
Lyophilized from 0.22µm filtered solution -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA -
Predicted molecular weight
35 kDa including tags -
Amino acids
49 to 118 -
Tags
Fc tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab155614 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
ELISA
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.75% Glycine, 0.605% Tris
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- IBP1
- IGF I
- IGF IA
see all -
Function
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. -
Involvement in disease
Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation. -
Sequence similarities
Belongs to the insulin family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Immobilized Recombinant human IGF1 protein (Active) (ab155614) at 5 μg/mL (100 μL/well) can bind Recombinant Human IGFBP3 protein (ab155611) with a linear range of 0.031-0.5 μg/mL.
-
Immobilized Human IGF-I R, His Tag (ab155622) at 5 μg/mL (100 μL/well) can bind Recombinant human IGF1 protein (Active) (ab155614) with a linear range of 0.039-0.313 μg/mL.
-
SDS-PAGE of reduced ab155614 stained overnight with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab155614 has been referenced in 1 publication.
- Kasprzycka P et al. The factors present in regenerating muscles impact bone marrow-derived mesenchymal stromal/stem cell fusion with myoblasts. Stem Cell Res Ther 10:343 (2019). PubMed: 31753006