Description

  • Product name

    Recombinant Human IGF1 protein (His tag)
    See all IGF1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA
    • Predicted molecular weight

      22 kDa
    • Amino acids

      49 to 118
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature chain without the signal peptide or propeptide.

Specifications

Our Abpromise guarantee covers the use of ab236939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • IBP1
    • IGF I
    • IGF IA
    • IGF IB
    • IGF-I
    • Igf1
    • IGF1_HUMAN
    • IGF1A
    • IGFI
    • IGFIA
    • Insulin like growth factor 1
    • Insulin like growth factor 1 (somatomedin C)
    • Insulin like growth factor IA
    • Insulin like growth factor IB
    • Insulin-like growth factor I
    • Mechano growth factor
    • MGF
    • OTTHUMP00000195080
    • OTTHUMP00000195081
    • OTTHUMP00000195082
    • OTTHUMP00000195083
    • OTTHUMP00000195084
    • Somatomedia C
    • Somatomedin C
    • Somatomedin-C
    see all
  • Function

    The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake.
  • Involvement in disease

    Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation.
  • Sequence similarities

    Belongs to the insulin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236939.

References

ab236939 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up