Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE
    • Molecular weight
      35 kDa
    • Amino acids
      25 to 91

Specifications

Our Abpromise guarantee covers the use of ab155617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured in a serum-free cell proliferation assay using MCF7 Human breast cancer cells.

    The ED50 for this effect is typically 2-10 ng/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Lyophilized from 0.22µm filtered solution
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 5% Trehalose, 0.75% Glycine, 0.605% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 10 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • C11orf43
    • IGF 2
    • IGF II
    • IGF-II
    • IGF2
    • IGF2_HUMAN
    • IGFII
    • INSIGF
    • Insulin like Growth Factor 2
    • insulin like growth factor 2 (somatomedin A)
    • Insulin like growth factor II
    • Insulin like growth factor II precursor
    • Insulin like growth factor type 2
    • pp9974
    • Preptin
    • putative insulin like growth factor II associated protein
    • Somatomedin A
    • Somatomedin-A
    see all
  • Function
    The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development.
    Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
  • Involvement in disease
    Epigenetic changes of DNA hypomethylation in IGF2 are a cause of Silver-Russell syndrome (SIRS) [MIM:180860]. SIRS is a clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations.
  • Sequence similarities
    Belongs to the insulin family.
  • Post-translational
    modifications
    O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab155617 stained overnight with Coomassie Blue.

References

ab155617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting us.


Since Fc fragment itself is a disulfide-linked homodimer with two identical polypeptide chains, one IGF2 polypeptide chain is fused to one of the two polypeptides of Fc fragment respectively to give a homodimer as well.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up