Bioactive grade

Recombinant human IGF2 protein (Animal Free) (Animal Free) (ab222173)

Description

  • Product name

    Recombinant human IGF2 protein (Animal Free) (Animal Free)
    See all IGF2 proteins and peptides
  • Biological activity

    Mouse FDC-P1 cell proliferation: ≤15 ng/mL; ≥ 6.7 x 104 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE
    • Predicted molecular weight

      8 kDa
    • Amino acids

      25 to 91
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 91. The signal peptide and propeptide are not included.
  • Description

    Recombinant human IGF2 protein (Animal Free)

Specifications

Our Abpromise guarantee covers the use of ab222173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile 0.2 micron filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.

General Info

  • Alternative names

    • C11orf43
    • IGF 2
    • IGF II
    • IGF-II
    • IGF2
    • IGF2_HUMAN
    • IGFII
    • INSIGF
    • Insulin like Growth Factor 2
    • insulin like growth factor 2 (somatomedin A)
    • Insulin like growth factor II
    • Insulin like growth factor II precursor
    • Insulin like growth factor type 2
    • pp9974
    • Preptin
    • putative insulin like growth factor II associated protein
    • Somatomedin A
    • Somatomedin-A
    see all
  • Function

    The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development.
    Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
  • Involvement in disease

    Epigenetic changes of DNA hypomethylation in IGF2 are a cause of Silver-Russell syndrome (SIRS) [MIM:180860]. SIRS is a clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations.
  • Sequence similarities

    Belongs to the insulin family.
  • Post-translational
    modifications

    O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 1 µg ab222173 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

  • ab222173 induced proliferation of FDC-P1 cells.

References

ab222173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up