Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLPRVGCPALPLPPPPLLPLLPLLLLLLGASGGGGGARAEVLFRCPPCTP ERLAACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEA CGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVA DNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTE QHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDER GPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGA PTIRGDPECHLFYNEQQEARGVHTQRMQ
    • Amino acids
      1 to 328
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BP 2
    • BP2
    • IBP 2
    • IBP-2
    • IBP2
    • IBP2_HUMAN
    • IGF binding protein 2
    • IGF BP53
    • IGF-binding protein 2
    • IGFBP 2
    • IGFBP-2
    • IGFBP2
    • IGFBP53
    • Insulin like growth factor binding protein 2
    • Insulin like growth factor binding protein 2 36kDa
    • Insulin like growth factor-binding protein 2 precursor
    • Insulin-like growth factor-binding protein 2
    see all
  • Function
    Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Sequence similarities
    Contains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Domain
    The C-terminus is required for IGF-binding and growth inhibition.
  • Post-translational
    modifications
    O-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158741 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up