Description

  • Product name

    Recombinant human IGFBP3 protein (Active)
    See all IGFBP3 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by inhibiting IGF-II induced proliferation of serum free human MCF-7 cells is less than 200 ng/ml, corresponding to a specific activity of >5.0x103 IU/mg in the presence of 15 ng/ml of rHuIGF-II.

  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSE GQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYL LPAPPAPGNASESEEDRSAGEVESPSVSSTHRVSDPKFHPLHSKIIIIKK GHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFL NVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTT KGKEDVHCYSMQSK
    • Predicted molecular weight

      29 kDa
    • Amino acids

      28 to 291
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab242214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Acid stable subunit of the 140 K IGF complex
    • Binding protein 29
    • Binding protein 53
    • BP 53
    • BP53
    • Growth hormone dependent binding protein
    • IBP 3
    • IBP-3
    • IBP3
    • IBP3_HUMAN
    • IGF binding protein 3
    • IGF-binding protein 3
    • IGFBP 3
    • IGFBP-3
    • IGFBP3
    • Insulin Like Growth Factor Binding Protein 3
    • Insulin-like growth factor binding protein 3 precursor
    • Insulin-like growth factor-binding protein 3
    see all
  • Function

    IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Tissue specificity

    Expressed by most tissues. Present in plasma.
  • Sequence similarities

    Contains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Developmental stage

    IGFBP3 levels are higher during extrauterine life and peak during puberty.
  • Domain

    The thyroglobulin type-1 domain mediates interaction with HN.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab242214.

References

ab242214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up