Bioactive grade

Recombinant human IGFBP4 protein (Active) (ab219674)

Description

  • Product name

    Recombinant human IGFBP4 protein (Active)
    See all IGFBP4 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab219674 at 2 μg/ml (100 µl/well), can bind Human IGF-I, Fc Tag with a linear range of 4-30 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYT PRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEG DHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQ GSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDG QRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      22 to 258
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 22 to 258. The signal peptide is not included (AAH16041).

Specifications

Our Abpromise guarantee covers the use of ab219674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • AI875747
    • BP 4
    • BP4
    • Deb2
    • HT29 IGFBP
    • IBP 4
    • IBP-4
    • IBP4
    • IBP4_HUMAN
    • IGF binding protein 4
    • IGF-binding protein 4
    • IGF-BP4
    • IGFBP 4
    • IGFBP-4
    • IGFBP4
    • Insulin Like Growth Factor Binding Protein 4
    • Insulin-like growth factor-binding protein 4
    see all
  • Function

    IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Sequence similarities

    Contains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab219674 stained overnight with Coomassie Blue.

    The reduced protein migrates as 33-37 kDa in SDS-PAGE due to glycosylation.

  • Immobilized ab219674 at 2 μg/ml (100 µl/well), can bind Human IGF-I, Fc Tag with a linear range of 4-30 ng/ml.

References

ab219674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up