Description

  • Product name

    Recombinant human IGFBP6 protein (Active)
    See all IGFBP6 proteins and peptides
  • Biological activity

    Determined by its ability to inhibit IGF-II induced proliferation of human MCF7 cells. The expected ED50 for this effect is 0.1 – 0.4 μg/ml.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    BTI-TN-5B1-4 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPN CAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTA RPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTE VYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPD GNGSSSCPTGSSG
    • Predicted molecular weight

      23 kDa
    • Amino acids

      28 to 240
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab245822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Migrates at an apparent molecular weight of approximately 23.0-30.0 kDa by SDS-PAGE analysis under non-reducing conditions.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 3.50
    Constituent: 0.29% Sodium citrate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to 0.1 - 1.0 mg/ml.

General Info

  • Alternative names

    • IBP 6
    • IBP-6
    • IBP6
    • IBP6_HUMAN
    • IGF binding protein 6
    • IGF-binding protein 6
    • IGFBP 6
    • IGFBP-6
    • IGFBP6
    • Insulin like growth factor binding protein 6
    • Insulin-like growth factor-binding protein 6
    see all
  • Function

    IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Sequence similarities

    Contains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications

    O-linked glycans consist of hexose (probably Gal), N-acetylhexosamine (probably GalNAc) and sialic acid residues. O-glycosylated with core 1 or possibly core 8 glycans. O-glycosylated on one site only in the region AA 143-168 in cerebrospinal fluid.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab245822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up