Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGA GRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTT YPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQ VYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEK HEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKK GEGAEL
    • Molecular weight
      26 kDa
    • Amino acids
      27 to 282

Specifications

Our Abpromise guarantee covers the use of ab50195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

  • Reconstitution
    Reconstitute to 1mg/ml using sterile water.

General Info

  • Alternative names
    • AGM
    • Angiomodulin
    • FSTL2
    • IBP-7
    • IBP7
    • IBP7_HUMAN
    • IGF binding protein 7
    • IGF-binding protein 7
    • IGFBP rP1
    • IGFBP-7
    • IGFBP-rP1
    • IGFBP7
    • IGFBPRP1
    • Insulin like growth factor binding protein 7
    • Insulin-like growth factor-binding protein 7
    • MAC25
    • MAC25 protein
    • PGI2 stimulating factor
    • PGI2-stimulating factor
    • Prostacyclin stimulating factor
    • Prostacyclin-stimulating factor
    • PSF
    • RAMSVPS
    • TAF
    • Tumor-derived adhesion factor
    see all
  • Function
    Binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab50195 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for your telephone enquiry this morning. As discussed on the telephone, this antibody can be reconstituted in sterile distilled water. If you include a carrier protein such as BSA, we recommend storing in working aliquots at -20oC for at least 3 months. If storing at 4oC, these can be kept for up to 1 week. I hope this will be helpful to you. Should you have any futher questions, please do not hesitate to contact us.

Read More

Answer

Thank you for your enquiry. With regards to our ab50195, we only make the non-glycosylated form of IGFBP7 and there is no information/data on glycolysated forms. Therefore, we are unable to say whether the glycosylated version would act the same or not. If you decide to go ahead and purchase this product, we encourage you to submit an Abreview via the online product datasheet. We always encourage customers to send their results back to us, whether positive or negative, and we make all product information available to researchers. To find out more about our Abreview system, please see the following URL: https://www.abcam.com/abreviews I am sorry I can't be of more assistance in this occasion but should you have any other questions, please do not hesitate to contact me.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up