Bioactive grade

Recombinant human IgG1 protein (Active) (Biotin) (ab246221)

Description

  • Product name

    Recombinant human IgG1 protein (Active) (Biotin)
    See all IgG1 proteins and peptides
  • Biological activity

    Assay #1: Immobilized Recombinant Protein A at 2 μg/mL (100 µl/well) can bind ab246221 with a linear range of 0.8-12.5 ng/mL.

    Assay #2: Immobilized Mouse CD16-2, His Tag at 5 μg/mL (100 μL/well) can bind ab246221 with a linear range of 0.01-0.313 μg/mL.

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      100 to 330
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.5
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • Ig gamma 1 chain C region
    • IgG heavy chain locus
    • IGHG1
    • Immunoglobulin Gm1
    • Immunoglobulin heavy constant gamma 1 (G1m marker)
    see all
  • Relevance

    There are four IgG subclasses (IgG1, 2, 3 and 4) in humans, named in order of their abundance in serum (IgG1 being the most abundant).
  • Cellular localization

    Secreted. Cell membrane; Single-pass membrane protein

Images

  • SDS-PAGE - Recombinant human IgG1 protein (Active) (Biotin) (ab246221).

    The gel was stained overnight with Coomassie Blue.

    As a result of glycosylation, the protein migrates as 36 kDa under reducing conditions (Lane 1), and 60-66 kDa under non-reducing conditions (Lane 2).

  • Immobilized Recombinant Protein A at 2 μg/mL (100 µl/well) can bind ab246221 with a linear range of 0.8-12.5 ng/mL.

  • Immobilized Mouse CD16-2, His Tag at 5 μg/mL (100 μL/well) can bind ab246221 with a linear range of 0.01-0.313 μg/mL.

References

ab246221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up