Recombinant human IgG2 protein (ab182668)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant human IgG2 protein
See all IgG2 proteins and peptides -
Biological activity
Human FCGRT & B2M Heterodimer Protein, His Tag (SPR & BLI verified) captured on CM5 Chip via anti-His antibody can bind ab182668 with an affinity constant of 33.3 nM as determined in SPR assay (Biacore 8K).
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEY KCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK -
Predicted molecular weight
26 kDa -
Amino acids
99 to 326
-
Specifications
Our Abpromise guarantee covers the use of ab182668 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Surface Plasmon Resonance
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.30
Constituents: PBS, 12% D-(+)-Trehalose dihydrate
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Ig gamma-2 chain C region
- IGHG2
- immunoglobulin Gm2
see all -
Relevance
There are four IgG subclasses (IgG1, 2, 3 and 4) in humans, named in order of their abundance in serum (IgG1 being the most abundant). IgG2 is the only IgG subclass which passes through the placenta at a level generally lower than that found in the mother. A deficiency of IgG2 indicates a poor antibody response to bacterial polysaccharides and can lead to increased susceptibility to infections caused by encapsulated bacteria. -
Cellular localization
Secreted
Images
-
Human IgG Fc (Tag Free) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The protein migrates as 33-35 kDa due to glycosylation.
-
Human FCGRT & B2M Heterodimer Protein, His Tag (SPR & BLI verified) captured on CM5 Chip via anti-His antibody can bind ab182668 with an affinity constant of 33.3 nM as determined in SPR assay (Biacore 8K).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab182668 has not yet been referenced specifically in any publications.