Description

  • Product name

    Recombinant Human IgG4 protein
    See all IgG4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQ EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ EGNVFSCSVMHEALHNHYTQKSLSLSLGK
    • Predicted molecular weight

      26 kDa
    • Amino acids

      99 to 327
    • Additional sequence information

      Fc Region.

Specifications

Our Abpromise guarantee covers the use of ab181968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, Sodium chloride, L-Arginine

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 200 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Ig gamma 4 chain C region
    • IGHG4
    • immunoglobulin heavy chain constant region gamma 4
    • Immunoglobulin heavy constant gamma 4 (G4m marker)
    • MGC117419
    see all
  • Relevance

    IgG4 antibodies will dominate the IgG response in schistosomiasis, lymphatic filariasis, and in patients after allergen immunotherapy. Unlike the other IgG subclasses, IgG4 does not activate complement. A combined IgA-IgG4 deficiency has been associated with recurrent pyogenic infections.
  • Cellular localization

    Secreted

Images

  • DTT-reduced (lane 1) and non-reduced (lane 2) SDS-PAGE analysis of ab181968 stained overnight with Coomassie Blue.

    As a result of glycosylation, DTT-reduced protein migrates as 33-35 kDa and non-reduced protein migrates as 50-55 kDa.

References

ab181968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up