Overview

  • Product name

    Recombinant Human IGSF1/p120 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTLDRPGEGATMLKTFTVLLFCIRMSLGMTSIVMDPQPELWIESNYPQAP WENITLWCRSPSRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESN AGLYRCCYWKETGWSKPSKVLELEAPGQLPKPIFWIQAETPALPGCNVNI LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR THIQMLPTLWSEPSNPLKLVVAGGCGYGCWHLAIVVPGIMAG
    • Amino acids

      1 to 242
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Product previously known as Recombinant Human IGSF1 protein.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • IGCD1
    • IGDC1
    • IgSF1
    • IGSF1_HUMAN
    • Immunoglobulin like domain containing protein 1
    • Immunoglobulin superfamily member 1
    • Immunoglobulin-like domain-containing protein 1
    • InhBP
    • Inhibin binding protein
    • Inhibin-binding protein
    • KIAA0364
    • MGC75490
    • p120
    • PGSF2
    • Pituitary gland specific factor 2
    • Pituitary gland-specific factor 2
    see all
  • Function

    Seems to be a coreceptor in inhibin signaling, but seems not to be a high-affinity inhibin receptor. Antagonizes activin A signaling in the presence or absence of inhibin B (By similarity). Necessary to mediate a specific antagonistic effect of inhibin B on activin-stimulated transcription.
  • Tissue specificity

    Highly expressed in pancreas, testis and fetal liver. Moderately expressed in heart, prostate and small intestine. Expressed at very low levels in brain, thymus, ovary, colon, fetal lung and fetal kidney. Expressed in muscle. Isoform 3 is expressed in pituitary gland.
  • Involvement in disease

    Hypothyroidism, central, and testicular enlargement
  • Sequence similarities

    Contains 12 Ig-like C2-type (immunoglobulin-like) domains.
  • Developmental stage

    Expressed in embryo Carnegie stage 18 in Rathke's pouch progenitors.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt

Images

  • ab158752 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up