Description

  • Product name

    Recombinant Human IGSF9 protein
  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SSFLRSPETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERLLPGLL PAAP RGSLTSQSSGRGSASFLRPPSTAPSAGGSYLSPAPGDTSSWASG PERWPRREHV VTVSKRRNTSVDENYEWDSEFPGDMELLETLHLGLASS RLRPEAEPELGVKTPE EGCLLNTAHVTGPEARCAALREEFLAFRRRRD ATRARLPAYRQPVPHPEQATLL
    • Amino acids

      948 to 1163

Specifications

Our Abpromise guarantee covers the use of ab91831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form

    Lyophilised
  • Additional notes

    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 4.50
    Constituents: 0.5% Trehalose, 36% Urea, 1.64% Sodium phosphate, 0.058% Sodium chloride

  • Reconstitution
    Reconstitute with 27 µl distilled water.

General Info

  • Alternative names

    • Dasm1
    • Dendrite arborization and synapse maturation protein 1
    • IGSF9 immunoglobulin superfamily, member 9
    • IGSF9A
    • Immunoglobulin superfamily member 9A
    • immunoglobulin superfamily, member 9
    • Ncaml
    • Nrt1
    • Protein turtle homolog A
    see all
  • Relevance

    IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type III domains and 5 Ig like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.
  • Cellular localization

    Cell membrane; Single-pass type I membrane protein.

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images colored control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab91831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up