Description

  • Product name

    Recombinant human IKKi/IKKe protein
  • Biological activity

    The specific activity of ab201367 was determined to be 12 nmol/min/mg as determined by kinase assay.

  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPRE VQVREFEVLRKLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLES PENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQ SIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGV TVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAIAGAQ RRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQ EYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVP KFVPKVDLQADYNTAKGVLGAGYQALRLARALLDGQELMFRGLHWVMEVL QATCRRTLEVARTSLLYLSSSLGTERFSSVAGTPEIQELKAAAELRSRLR TLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKM NFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELS HQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDN NRIIERLNRVPAPPDV
    • Predicted molecular weight

      110 kDa including tags
    • Amino acids

      1 to 716
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab201367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab204863 (IKB alpha peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • I kappa B kinase epsilon
    • I-kappa-B kinase epsilon
    • IkBKE
    • IKK related kinase epsilon
    • IKK-E
    • IKK-epsilon
    • IKK-i
    • IKKE
    • IKKE_HUMAN
    • IKKepsilon
    • IKKI
    • Inducible I kappa B kinase
    • Inducible I kappa-B kinase
    • Inducible IkappaB kinase
    • Inhibitor of kappa light polypeptide gene enhancer in B cells kinase epsilon
    • Inhibitor of kappa light polypeptide gene enhancer in B cells, kinase of, epsilon
    • Inhibitor of nuclear factor kappa-B kinase subunit epsilon
    • KIAA0151
    • MGC125294
    • MGC125295
    • MGC125297
    see all
  • Function

    Phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. May play a special role in the immune response. Protects cells against DNA damage-induced cell death.
  • Tissue specificity

    Highly expressed in spleen followed by thymus, peripheral blood leukocytes, pancreas, placenta. Weakly expressed in lung, kidney, prostate, ovary and colon.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. I-kappa-B kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
    Sumoylation by TOPORS upon DNA damage is required for protection of cells against DNA damage-induced cell death. Desumoylated by SENP1.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus > PML body. Targeting to PML nuclear bodies upon DNA damage is TOPORS-dependent.
  • Information by UniProt

Images

  • The specific activity of IKKi/IKKe (ab201367) was determined to be 11 nmol/min/mg as per activity assay protocol
  • SDS PAGE analysis of ab201367
  • SDS PAGE analysis of ab201367
  • Specific activity of ab201367

  • SDS PAGE analysis of ab201367

References

ab201367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up