Description

  • Product name

    Recombinant human IL-1 alpha protein (Animal Free)
    See all IL-1 alpha proteins and peptides
  • Biological activity

    Determined by its ability to stimulate the proliferation of mouse D10S cells. The expected ED50 is ≤0.001 ng/ml, corresponding to a specific activity of ≥1 x 109 units/mg.

  • Purity

    > 98 % SDS-PAGE.
    > 98% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDE AVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPK TITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSIT DFQILENQA
    • Predicted molecular weight

      18 kDa
    • Amino acids

      113 to 271
    • Additional sequence information

      This product is the mature full length protein from aa 113 to 271. The propeptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab217408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • BAF
    • FAF
    • Hematopoietin 1
    • Hematopoietin-1
    • IL 1 alpha
    • IL 1A
    • IL-1 alpha
    • Il-1a
    • IL1
    • IL1 ALPHA
    • IL1A
    • IL1A_HUMAN
    • IL1F1
    • Interleukin 1 alpha
    • Interleukin-1 alpha
    • Interleukin1 alpha
    • LAF
    • LEM
    • Preinterleukin 1 alpha
    • Pro interleukin 1 alpha
    see all
  • Function

    Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Domain

    The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
  • Cellular localization

    Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
  • Information by UniProt

References

ab217408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up