Description

  • Product name

    Recombinant Human IL-10RA protein (His tag)
    See all IL-10RA proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab201890 was purified using conventional chromatography.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNS ISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVD EVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAI RKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKE ECISLTRQYFTVTNHHHHHH
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      22 to 235
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No.: NP_001549

Specifications

Our Abpromise guarantee covers the use of ab201890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 89% PBS, 10% Glycerol

General Info

  • Alternative names

    • CD210
    • CDw210a
    • CDw210a antigen
    • HIL 10R
    • HIL10R
    • I10R1_HUMAN
    • IL 10R
    • IL 10R 1
    • IL 10R A
    • IL 10R1
    • IL-10 receptor subunit alpha
    • IL-10R subunit 1
    • IL-10R subunit alpha
    • IL-10R1
    • IL-10RA
    • IL10R
    • IL10R1
    • IL10RA
    • Interleukin 10 receptor alpha
    • Interleukin 10 receptor alpha chain
    • Interleukin-10 receptor subunit 1
    • Interleukin-10 receptor subunit alpha
    see all
  • Function

    Receptor for IL10; binds IL10 with a high affinity.
  • Tissue specificity

    Spleen, thymus, and PBMC. Weak expression in pancreas, skeletal muscle, brain, heart, and kidney. Placenta, lung, and liver showed intermediate levels. Monocytes, B-cells, large granular lymphocytes, and T-cells express high levels.
  • Involvement in disease

    Inflammatory bowel disease 28
  • Sequence similarities

    Belongs to the type II cytokine receptor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab201890 (3 µg)

References

ab201890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up