Recombinant Human IL-10RB / IL-10R2 protein (ab191962)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNT TLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQ VEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQI TPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVP SVDHHHHHH
    • Molecular weight
      25 kDa including tags
    • Amino acids
      20 to 220
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab191962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

General Info

  • Alternative names
    • Cd210
    • CDw210b
    • CRF2 4
    • CRF2-4
    • CRFB4
    • Cytokine receptor class II
    • Cytokine receptor class II CRF2 4
    • Cytokine receptor class-II member 4
    • Cytokine receptor family 2 member 4
    • Cytokine receptor family II member 4
    • D21S58
    • D21S66
    • I10R2_HUMAN
    • IL-10 receptor subunit beta
    • IL-10R subunit 2
    • IL-10R subunit beta
    • IL-10R2
    • IL-10RB
    • IL10R2
    • IL10RB
    • Interleukin 10 receptor beta
    • Interleukin-10 receptor subunit 2
    • Interleukin-10 receptor subunit beta
    see all
  • Function
    Shared cell surface receptor required for the activation of five class 2 cytokines: IL10, IL22, IL26, IL28, and IL29.
  • Involvement in disease
    Defects in IL10RB are the cause of inflammatory bowel disease type 25 (IBD25) [MIM:612567]. It is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
  • Sequence similarities
    Belongs to the type II cytokine receptor family.
    Contains 2 fibronectin type-III domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab191962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up