Recombinant Human IL-10RB/IL-10R2 protein (Fc Chimera His Tag) (ab227419)

Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNT TLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQ VEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQI TPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVP SLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Molecular weight

      51 kDa including tags
    • Amino acids

      20 to 220
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgG-His-tag at C-terminal (NP_000619).

Specifications

Our Abpromise guarantee covers the use of ab227419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab227419 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Previously labelled as IL10RB.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • Cd210
    • CDw210b
    • CRF2 4
    • CRF2-4
    • CRFB4
    • Cytokine receptor class II
    • Cytokine receptor class II CRF2 4
    • Cytokine receptor class-II member 4
    • Cytokine receptor family 2 member 4
    • Cytokine receptor family II member 4
    • D21S58
    • D21S66
    • I10R2_HUMAN
    • IL-10 receptor subunit beta
    • IL-10R subunit 2
    • IL-10R subunit beta
    • IL-10R2
    • IL-10RB
    • IL10R2
    • IL10RB
    • Interleukin 10 receptor beta
    • Interleukin-10 receptor subunit 2
    • Interleukin-10 receptor subunit beta
    see all
  • Function

    Shared cell surface receptor required for the activation of five class 2 cytokines: IL10, IL22, IL26, IL28, and IL29.
  • Involvement in disease

    Defects in IL10RB are the cause of inflammatory bowel disease type 25 (IBD25) [MIM:612567]. It is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
  • Sequence similarities

    Belongs to the type II cytokine receptor family.
    Contains 2 fibronectin type-III domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227419.

    MW 50-70 kDa (SDS-PAGE under reducing conditions).

References

ab227419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up