Recombinant human IL-11 protein (Animal Free) (ab222362)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human IL-11 protein (Animal Free)
See all IL-11 proteins and peptides -
Biological activity
T11 cell proliferation: ED50 ≤2.5 ng/ml; ≥ 4.0 x 105 units/mg.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDH NLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGG IRAAHAILGGLHLTLDWAVRGLLLLKTRL -
Predicted molecular weight
19 kDa -
Amino acids
22 to 199 -
Additional sequence information
This product is the mature full length protein from aa 22 to 199. The signal peptide is not included.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab222362 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acid
Lyophilized from a sterile 0.2 micron filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial before opening. Suspend the product by gently pipetting sterile water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C. Avoid repeat freeze thaw. Upon reconstitution, a small amount of visible precipitate can be expected. A 10% overfill has been added to the total material vialed to compensate for this loss.
General Info
-
Alternative names
- Adipogenesis inhibitory factor
- AGIF
- IL 11
see all -
Function
Directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab222362 has not yet been referenced specifically in any publications.