Description

  • Product name

    Recombinant human IL-12 protein
    See all IL-12 proteins and peptides
  • Biological activity

    The bio-activity was determined by the dose-dependent release of IFN-gamma from the human NK92 cell line in presence of 20 ng/mL rhIL-2.

    The ED50 < 0.2 ng/mL, corresponding to a specific activity of >5,000,000 Unit/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHE DITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMAL CLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNF NSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
    • Predicted molecular weight

      24 kDa
    • Amino acids

      23 to 219
    • Additional sequence information

      This product is for the mature full length protein from aa 23 to 219. The signal peptide is not included. IL12A forms a heterodimer with IL12B.
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSG KTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKE PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEN YTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLT FCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEW ASVPCS
    • Predicted molecular weight

      37 kDa
    • Amino acids

      23 to 328
    • Additional sequence information

      This product is for the mature full length IL12B from aa 23 to 328. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab201430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 97% PBS, 3% Trehalose

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is about 3-5%. Lyophilized from 0.22 µm filtered solution

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 10 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CLMF
    • CLMF p35
    • CLMF p40
    • CLMF1
    • CLMF2
    • Cytotoxic lymphocyte maturation factor 1, p35
    • Cytotoxic lymphocyte maturation factor 2
    • Cytotoxic lymphocyte maturation factor 35 kDa subunit
    • Cytotoxic lymphocyte maturation factor 40 kDa subunit
    • IL 12A
    • IL 2 subunit p40
    • IL-12 subunit p35
    • IL-12A
    • IL-12B
    • IL12
    • IL12, p35 subunit
    • IL12, subunit p40
    • IL12A
    • IL12A_HUMAN
    • IL12B
    • IL35 subunit
    • Interleukin 12 alpha chain
    • Interleukin 12 beta chain
    • Interleukin 12 subunit beta
    • Interleukin 12, p40
    • Interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
    • Interleukin 12B
    • Interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
    • Interleukin-12 subunit alpha
    • Natural killer cell stimulatory factor 1, 35 kD subunit
    • natural killer cell stimulatory factor 2
    • Natural killer cell stimulatory factor, 40 kD subunit
    • NF cell stimulatory factor chain 1
    • NFSK
    • NK cell stimulatory factor chain 1
    • NK cell stimulatory factor chain 2
    • NKSF
    • NKSF1
    • NKSF2
    • P35
    see all
  • Function

    Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Human IL12B & IL12A Heterodimer Protein (His Tag & Flag Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
  • Immobilized Biotinylated Human IL-12 R beta 1, Fc,Avitag at 1 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate, can bind ab201430 with a linear range of 0.039-0.625 μg/mL 

  • Immobilized ab201430 at 0.5 μg/mL (100 μL/well) can bind Anti-IL23A & IL12B MAb (P40 domain) with a linear range of 0.2-2 ng/mL

  • The purity of ab201430 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced heterodimer protein migrates as 33-47 kDa due to glyosylation.

References

ab201430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up