Description

  • Product name

    Recombinant human IL-12 protein
    See all IL-12 proteins and peptides
  • Biological activity

    The ED50 was determined by the induction of IFN-γ from NK cells co-stimulated with IL18 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥1 x 106 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.010 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSG KTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKE PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEN YTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLT FCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEW ASVPCS
    • Predicted molecular weight

      35 kDa
    • Amino acids

      23 to 328
    • Additional sequence information

      P40 subunit mature full length protein. The signal peptide is not included. (NP_002178.2).
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHE DITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMAL CLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNF NSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
    • Predicted molecular weight

      23 kDa
    • Amino acids

      23 to 219
    • Tags

      His tag C-Terminus
    • Additional sequence information

      P35 subunit mature full length protein fused at the C-terminus through a (G3S)4 linker to a His-tag (NP_000873.2).

Specifications

Our Abpromise guarantee covers the use of ab214145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    0.2µm-filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µl sterile water to a concentration of 0.1mg/ml. Add 1X PBS to the desired protein concentration. PBS containing at least 0.1% BSA should be used for further dilutions.

General Info

  • Alternative names

    • CLMF
    • CLMF p35
    • CLMF p40
    • CLMF1
    • CLMF2
    • Cytotoxic lymphocyte maturation factor 1, p35
    • Cytotoxic lymphocyte maturation factor 2
    • Cytotoxic lymphocyte maturation factor 35 kDa subunit
    • Cytotoxic lymphocyte maturation factor 40 kDa subunit
    • IL 12A
    • IL 2 subunit p40
    • IL-12 subunit p35
    • IL-12A
    • IL-12B
    • IL12
    • IL12, p35 subunit
    • IL12, subunit p40
    • IL12A
    • IL12A_HUMAN
    • IL12B
    • IL35 subunit
    • Interleukin 12 alpha chain
    • Interleukin 12 beta chain
    • Interleukin 12 subunit beta
    • Interleukin 12, p40
    • Interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
    • Interleukin 12B
    • Interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
    • Interleukin-12 subunit alpha
    • Natural killer cell stimulatory factor 1, 35 kD subunit
    • natural killer cell stimulatory factor 2
    • Natural killer cell stimulatory factor, 40 kD subunit
    • NF cell stimulatory factor chain 1
    • NFSK
    • NK cell stimulatory factor chain 1
    • NK cell stimulatory factor chain 2
    • NKSF
    • NKSF1
    • NKSF2
    • P35
    see all
  • Function

    Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab214145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up