Recombinant human IL-12 p70 protein (Active) (ab259418)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: < 0.005 Eu/µg
- Active: Yes
- Suitable for: Cell Culture, SDS-PAGE, HPLC, Functional Studies, MS
Description
-
Product name
Recombinant human IL-12 p70 protein (Active) -
Biological activity
Fully biologically active compared to a standard. ED50 as determined by the dose-dependant proliferation of NK-92 cells is 0.86 ng/mL corresponding to a Specific Activity of 1.16 x 106 IU/mg.
-
Purity
>= 95 % SDS-PAGE.
Purity by HPLC >=95%. -
Endotoxin level
< 0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Amino Acid Sequence 1
-
Species
Human -
Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSG KTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKE PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEN YTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLT FCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEW ASVPCS -
Predicted molecular weight
35 kDa -
Molecular weight information
M + 2.97 Da (Calc mass 34754.03 Da) -
Amino acids
23 to 328 -
Additional sequence information
Full-length mature IL-12 p40 subunit lacking the signal peptide. ab259418 is a heterodimeric glycoprotein consisting of disulfide-linked p40 and p35 subunits (503 total amino acid residues).
-
Amino Acid Sequence 2
-
Species
Human -
Sequence
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHE DITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMAL CLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNF NSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS -
Predicted molecular weight
23 kDa -
Molecular weight information
M + 2.8 Da (Calc. mass 22599.2 Da). -
Amino acids
23 to 219 -
Additional sequence information
Full-length mature IL-12 p35 subunit lacking the signal peptide. ab259418 is a heterodimeric glycoprotein consisting of disulfide-linked p40 and p35 subunits (503 total amino acid residues).
-
Specifications
Our Abpromise guarantee covers the use of ab259418 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Cell Culture
SDS-PAGE
HPLC
Functional Studies
Mass Spectrometry
-
Form
Lyophilized -
Additional notes
This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment.
IL-12 p70 is a disulfide bonded heterodimer of the IL-12 40 kDa and 35 kDa subunits.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 6.00
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose
Buffer lyophilized from.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- IL12A
- IL12B
- CLMF p35
see all -
Relevance
IL-12 p70 is a disulfide bonded heterodimer of the IL-12 40 kDa and 35 kDa subunits. -
Cellular localization
Secreted
Images
-
SDS-PAGE analysis of ab259418.
Protein is a heterodimer.
-
Purity 96%.
The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 µm). 5 µL of purified protein was injected and the gradient run from 80 % water:TFA (99.9:0.1 v/v) and 20 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) to 20 % water:TFA (99.9:0.1 v/v) and 80 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.
-
M + 2.8 Da (Calc. mass 22599.2 Da).
The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).
-
M + 2.97 Da (Calc mass 34754.03 Da).
The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab259418 has not yet been referenced specifically in any publications.