Recombinant Human IL-12B protein (Fc Chimera) (ab221319)

Description

  • Product name

    Recombinant Human IL-12B protein (Fc Chimera)
    See all IL-12B proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSG KTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKE PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEN YTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLT FCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEW ASVPCS
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      23 to 328
    • Additional sequence information

      Fused with a human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus (AAH67499). This product is the mature full length protein from aa 23 to 328. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab221319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: Tris, Glycine, L-Arginine, Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CLMF
    • CLMF p40
    • CLMF2
    • Cytotoxic lymphocyte maturation factor 40 kDa subunit
    • IL-12 subunit p40
    • IL-12B
    • IL12B
    • IL12B_HUMAN
    • IMD28
    • IMD29
    • Interleukin-12 subunit beta
    • NK cell stimulatory factor chain 2
    • NKSF
    • NKSF2
    see all
  • Function

    Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
    Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
  • Involvement in disease

    Mendelian susceptibility to mycobacterial disease
    Psoriasis 11
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 3 subfamily.
    Contains 1 fibronectin type-III domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Known to be C-mannosylated in the recombinant protein; it is not yet known for sure if the wild-type protein is also modified.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab221319 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 70-80 kDa in SDS-PAGE due to glycosylation.

References

ab221319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up